Mouse CD86, his tag
SKU: 83463805016

Mouse CD86, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD86, his tagProduct Specification Species Mouse Synonyms Activation B7 2 antigen,Early T cell costimulatory molecule 1 (ETC 1) Accession P42082 Amino Acid Sequence Protein sequence (P42082, Val24 Lys244, with C 10*His) VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKGGGGSHHHHHHHHHH Expression

Product Specification


Species Mouse
Synonyms Activation B7-2 antigen,Early T-cell costimulatory molecule 1 (ETC-1)
Accession P42082
Amino Acid Sequence

Protein sequence (P42082, Val24-Lys244, with C-10*His) VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26.8 kDa Observed MW: 30-70 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Cluster of Differentiation 86 (also known as CD86 and B7-2) is a protein constitutively expressed on dendritic cells, Langerhans cells, macrophages, B-cells (including memory B-cells), and on other antigen-presenting cells. Along with CD80, CD86 provides costimulatory signals necessary for T cell activation and survival. Depending on the ligand bound, CD86 can signal for self-regulation and cell-cell association, or for attenuation of regulation and cell-cell disassociation. The CD86 gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. Alternative splicing results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 83463805016

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 2381 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
B. Billy
Carnegie, US
★★★★★ 4
Not real Black Iron, but works just as well
Size: 42inch Tall (NOT included wood planks), Color: Black
First, these parts that I got were not real Black Iron pipes like you would pick up at a hardware store, they are like furniture grade tubes for an IKEA shelving system. The thread would fit 3/4 pipe from like HD, but they are not the same, I know this because I just bought some of the pipe and parts for a small shelf right before ordering this. I should have known from the price, the real stuff is kind of pricey, but nicer. The elbows and T-connectors as well as the flanges seem more like galvanized steel painted black. HOWEVER, the end product is pretty nice and very versatile as to where you would want to put it. It is still pretty sturdy, and if screwed into a stud, I believe it would hold a lot of weight. The entire shelving system is painted black, so unlike Black Iron, it will not stain your hands black when handling it. Putting this together took about 30 min, the longest part was adjusting angles and lengths to get it flat and squared, but was not hard at all. This kit does NOT come with shelf boards, so length of that is up to you. It also came with mounting screws, but they are thin and I would suggest as your getting boards for shelves, also pick up some beefier screws, U used #12 - 1 1/4" wood screws with the sleeves for drywall and a little longer for securing it into a stud. All in all, this black pipe shelf looks nice, is nice and will work out great, just know, it is not the real Black Iron pipes and parts you would get from a hardware store, but the threads would fit if you wanted to add to this. I only knocked down one star because of this, and if I am going to buy more of these, I would prefer the real stuff and not go with this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2020
K
Verified Purchase
Kristin Miller
Carnegie, US
★★★★★ 5
Love these!!!
Size: 42inch Tall (NOT included wood planks), Color: Black
Super sturdy..looks excellent. Industrial and clean lines....lots of space for our kids bathroom. The wood does not come with it but was easy to get lowes. We actually added another shelf on the top bracket to make 4 shelves. They're nice and wide to fit baskets and organize things. For teenagers bathroom! My husband installed by himself and he isn't the handiest of guys but it it wasn't bad. I do recommend getting pipe fastners to secure the boards to the pipes so they don't shift around
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2021
S
Verified Purchase
S. Meunier
Grantham, US
★★★★★ 5
Nice pipe shelves! Excellent quality!
Size: 28inch Tall (NOT included wood planks), Color: Black
I really like the fact that the pieces were already painted. I compared the cost of the unit to buying the pieces from the big box store and this was far more cost effective for me. The installation went well and I ended up creating a template for installation. For the template, I measured the width of one of the flanges (part that mounts to the wall), cut a piece of material the same width. I found the center and drew a line down the middle. I then placed the section with top and bottom holes over the center line and then marked the other two holes. I then drilled out the holes, put on wall and used level to plumb. I used small pilot drill bit to drill through the template into the wall. One thing to note is that I did not use the included anchors instead opting for some from the big box store.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2020
H
Verified Purchase
hman
Massapequa, US
★★★★★ 5
Well built and priced
Size: 42inch Tall (NOT included wood planks), Color: Black
I saw these on line and decided I could probably just build one on my own. After pricing the parts out at the local hardware store, it was almost the same price, and opted for the less hassle pre-fab online kit. The material is well made, same as the hardware store, except the threads are shorter for easier assembly, and its painted for a cleaner look. I bought the 12"Dx42"L kit, and although I knew the measurements, it was a lot more massive than it looked in the picture. An 8' or 10"x 24"L kit would have fit my needs better. I only assembled 2 of the 3 sections, and will use the single section leftover for another shelf elsewhere, so it wasn't a problem. I'm happy with the end result and would recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 28, 2020
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 5
So beautiful!
Size: 42inch Tall (NOT included wood planks), Color: Black, Size: 42inch Tall (NOT included wood planks), Color: Black
The poles are very sturdy. The order doesn’t come with wood but I only spent ~$15-20 on the wood and stain needed to shelve the poles. The only complaint I have is it was hard to install; mostly due to my lack of experience. It took most of the day to install and stain and cute the shelves. The poles weren’t completely flush to the wall and I couldn’t figure it out for the life of me. I love the way these turned out and I know these shelves will be coming with me to the next home I have. 10/10 would recommend, even with the hard installation. SO worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 26, 2019

recommand products