Human CD28, His tag
SKU: 28672499787

Human CD28, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD28, His tagProduct Specification Species Human Synonyms TP44 Accession P10747 Amino Acid Sequence Protein sequence(P10747, Asn19 Pro152, with C 10*His) NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 8 kDa Actual: 30 47 kDa Purity >95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance

Product Specification


Species Human
Synonyms TP44
Accession P10747
Amino Acid Sequence

Protein sequence(P10747, Asn19-Pro152, with C-10*His) NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:16.8 kDa Actual:30-47 kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD28 (Cluster of Differentiation 28) is one of the proteins expressed on T cells that provide co-stimulatory signals required for T cell activation and survival. T cell stimulation through CD28 in addition to the T-cell receptor (TCR) can provide a potent signal for the production of various interleukins (IL-6 in particular). CD28 is the receptor for CD80 (B7.1) and CD86 (B7.2) proteins. CD28 is the only B7 receptor constitutively expressed on naive T cells. CD28 was also identified on bone marrow stromal cells, plasma cells, neutrophils and eosinophils. As a homodimer of two chains with Ig domains binds B7 molecules on APCs and it can promotes T cells proliferation and differentiation, stimulates production of growth factors and induces the expression of anti-apoptotic proteins.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28672499787

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 644 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Paula
Draper, US
★★★★★ 5
Entrega rápida y en perfecto estado.
Format: Hardcover, Format: Hardcover
Para ser un libro de segunda y tener la etiqueta de "aceptable", yo lo veo en muy buenas condiciones. Se nota un poquito de uso, pero está en perfecto estado. Me encantó.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
A
Verified Purchase
Alex
Carnegie, US
★★★★★ 5
The Sweet Beginning of Charlie and Nick's Journey!
Format: Hardcover
Heartstopper Volume 1 marks the delightful start of Charlie and Nick's heartwarming story, offering readers a charming introduction to their friendship and the blossoming of something more. Alice Oseman's debut in the Heartstopper series lays the foundation for a narrative that is as touching as it is relatable. The characters come to life through Oseman's expressive illustrations, capturing the nuances of teenage life with authenticity. Volume 1 introduces us to Charlie and Nick, two characters who quickly become endearing with their genuine personalities and the magnetic pull of their connection. Oseman's storytelling shines through in this initial installment, effortlessly blending humor, friendship, and the tender moments that make readers fall in love with the characters. The simplicity of the narrative belies its emotional depth, creating a story that resonates on a profound level. The visual elements are a highlight, with the artwork adding layers of emotion and personality to the characters. Volume 1 is a testament to Oseman's talent for crafting narratives that tug at the heartstrings while providing a genuine and honest portrayal of relationships. Whether you're a seasoned graphic novel enthusiast or a newcomer to the genre, Heartstopper Volume 1 is a delightful read that sets the stage for a series filled with love, friendship, and self-discovery. It earns a well-deserved five stars for its sweet beginning and the promise of more heartwarming moments to come!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2023
A
Always Be Dancing
Carnegie, US
★★★★★ 5
A beautifully written and illustrated tale of kindness, courage and (imaginary) friendship
Format: Hardcover
A beautifully written and illustrated tale of kindness, courage and friendship (even if the friend is in your imagination). This is a great picture book for building self-esteem and for helping early learners to discover ways to overcome obstacles by showing how upbeat confidence boosting self-talk is the way to go. I adore this beautiful family and how the climb up the slide's stairs is so relatable-you just feel the endless up, up, up as you ascend, like climbing up the stairs of the high dive and looking down and just that whoosh of fear that vertakes you from the seemingly dizzying height. I love the kindness on all the adults' faces and the cute expressions from the child. The lion is magnificent. I love that it gives shape to a child’s imaginary friend and that this friend is a true safety net -which is really the child being their own safety net. The end pages are bright orange and sunny, using the cute lion face in the pattern and all the illustrations, which are predominantly blue and yellow/orange illustrations are the perfect backdrop for the tumble of dark curls on the child’s head which allow the size of the lion to appear gigantic, and yet, calm and sweet like a kitty cat. Very sweet book! I love its message of bravery, confidence building and how you can truly be your own best friend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2023
S
Sara R
New York, US
★★★★★ 5
Sweet Story about facing your fears!
Format: Hardcover
A trusted comrade, a little girl’s lion is always there. Her lion helps her through times of stress, or if she makes a mistake, or if she is nervous. A girl and her lion, the dream team! One day the little girl goes on a new adventure, a brand new slide arrived at the playground and she can’t wait to try it with Lion. The ladder is a bit taller than she thought and with every climb, uncertainty starts to creep in. This slide is so high! How will we ever get down? The young girl wonders. Turning back towards Lion (since this is usually the part her brave lion steps in to help) she notices that he is afraid too! This is such a sweet story about facing your fears! I love the bright yellow and orange with blue color palette. Having a lion inside to symbolize bravery is such a wonderful way to help young readers with facing their fears. We love to teach our children that fear is a healthy response, it’s a message that our body is giving us! It is also healthy to work past that fear (although sometimes we need some help doing just that).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2024
L
LibraryMom
Houston, US
★★★★★ 5
Love!
Format: Hardcover
A little girl feels like she can courageously tackle anything with the help of her brave lion. When she climbs a tall slide, however, and her lion becomes afraid, she must summon her own strength to overcome her fear.  I especially love the illustrations in this validating and reassuring read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 5, 2023

recommand products