Human IL-13, His tag
SKU: 84114699511

Human IL-13, His tag

$180.00 $200.00
Save 10%
No.2 Bestseller on kancelaria-przasnysz.pl >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-13, His tagProduct Specification Species Human Synonyms NC30 Accession P35225 Amino Acid Sequence Protein sequence(P35225, Gly35 Asn146 with C 10*His) GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 0 kDa Actual: 25 35 kDa Purity 95% by SDS PAGE Endotoxin <1EU mg Tag with C 10*His Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms NC30
Accession P35225
Amino Acid Sequence

Protein sequence(P35225, Gly35-Asn146 with C-10*His) GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:14.0 kDa Actual:25-35 kDa
Purity ＞95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. IL-13 was first cloned in 1993 and is located on chromosome 5q31.1 with a length of 1.4kb. It has a mass of 13 kDa and folds into 4 alpha helical bundles. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence identity to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84114699511

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 2181 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
B. Billy
Grantham, US
★★★★★ 4
Not real Black Iron, but works just as well
Size: 42inch Tall (NOT included wood planks), Color: Black
First, these parts that I got were not real Black Iron pipes like you would pick up at a hardware store, they are like furniture grade tubes for an IKEA shelving system. The thread would fit 3/4 pipe from like HD, but they are not the same, I know this because I just bought some of the pipe and parts for a small shelf right before ordering this. I should have known from the price, the real stuff is kind of pricey, but nicer. The elbows and T-connectors as well as the flanges seem more like galvanized steel painted black. HOWEVER, the end product is pretty nice and very versatile as to where you would want to put it. It is still pretty sturdy, and if screwed into a stud, I believe it would hold a lot of weight. The entire shelving system is painted black, so unlike Black Iron, it will not stain your hands black when handling it. Putting this together took about 30 min, the longest part was adjusting angles and lengths to get it flat and squared, but was not hard at all. This kit does NOT come with shelf boards, so length of that is up to you. It also came with mounting screws, but they are thin and I would suggest as your getting boards for shelves, also pick up some beefier screws, U used #12 - 1 1/4" wood screws with the sleeves for drywall and a little longer for securing it into a stud. All in all, this black pipe shelf looks nice, is nice and will work out great, just know, it is not the real Black Iron pipes and parts you would get from a hardware store, but the threads would fit if you wanted to add to this. I only knocked down one star because of this, and if I am going to buy more of these, I would prefer the real stuff and not go with this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2020
K
Verified Purchase
Kristin Miller
Port Orchard, US
★★★★★ 5
Love these!!!
Size: 42inch Tall (NOT included wood planks), Color: Black
Super sturdy..looks excellent. Industrial and clean lines....lots of space for our kids bathroom. The wood does not come with it but was easy to get lowes. We actually added another shelf on the top bracket to make 4 shelves. They're nice and wide to fit baskets and organize things. For teenagers bathroom! My husband installed by himself and he isn't the handiest of guys but it it wasn't bad. I do recommend getting pipe fastners to secure the boards to the pipes so they don't shift around
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2021
S
Verified Purchase
S. Meunier
San Leandro, US
★★★★★ 5
Nice pipe shelves! Excellent quality!
Size: 28inch Tall (NOT included wood planks), Color: Black
I really like the fact that the pieces were already painted. I compared the cost of the unit to buying the pieces from the big box store and this was far more cost effective for me. The installation went well and I ended up creating a template for installation. For the template, I measured the width of one of the flanges (part that mounts to the wall), cut a piece of material the same width. I found the center and drew a line down the middle. I then placed the section with top and bottom holes over the center line and then marked the other two holes. I then drilled out the holes, put on wall and used level to plumb. I used small pilot drill bit to drill through the template into the wall. One thing to note is that I did not use the included anchors instead opting for some from the big box store.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2020
H
Verified Purchase
hman
Lowell, US
★★★★★ 5
Well built and priced
Size: 42inch Tall (NOT included wood planks), Color: Black
I saw these on line and decided I could probably just build one on my own. After pricing the parts out at the local hardware store, it was almost the same price, and opted for the less hassle pre-fab online kit. The material is well made, same as the hardware store, except the threads are shorter for easier assembly, and its painted for a cleaner look. I bought the 12"Dx42"L kit, and although I knew the measurements, it was a lot more massive than it looked in the picture. An 8' or 10"x 24"L kit would have fit my needs better. I only assembled 2 of the 3 sections, and will use the single section leftover for another shelf elsewhere, so it wasn't a problem. I'm happy with the end result and would recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 28, 2020
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 5
So beautiful!
Size: 42inch Tall (NOT included wood planks), Color: Black, Size: 42inch Tall (NOT included wood planks), Color: Black
The poles are very sturdy. The order doesn’t come with wood but I only spent ~$15-20 on the wood and stain needed to shelve the poles. The only complaint I have is it was hard to install; mostly due to my lack of experience. It took most of the day to install and stain and cute the shelves. The poles weren’t completely flush to the wall and I couldn’t figure it out for the life of me. I love the way these turned out and I know these shelves will be coming with me to the next home I have. 10/10 would recommend, even with the hard installation. SO worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 26, 2019

recommand products

DR 1634 - The Winnats & Entrance, Speedwell Cavern, Derbyshire
13.00
DR 1622 - High Street & Zion Church, Long Eaton, Derbyshire c1920
13.00
DR 1577 - Heanor Parish Church, Derbyshire c1957
13.00
DR 2097 - Normanton Picture Palace, Derbyshire
13.00
DR 2075 - Bakewell Union Workhouse, Derbyshire
10.95