Mouse CD95, his tag
SKU: 86101970480

Mouse CD95, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 6 - Jul 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD95, his tagProduct Specification Species Mouse Synonyms Apo 1 antigen, Apoptosis mediating surface antigen FAS, FASLG receptor, Apt1, Tnfrsf6 Accession P25446 Amino Acid Sequence Protein sequence (P25446, Gln22 Arg169, with C 10*His) QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 18. 2 kDa

Product Specification


Species Mouse
Synonyms Apo-1 antigen, Apoptosis-mediating surface antigen FAS, FASLG receptor, Apt1, Tnfrsf6
Accession P25446
Amino Acid Sequence

Protein sequence (P25446, Gln22-Arg169, with C-10*His) QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 18.2 kDa Observed MW: 23-30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The Fas receptor, also known as Fas, FasR, apoptosis antigen 1 (APO-1 or APT), cluster of differentiation 95 (CD95) or tumor necrosis factor receptor superfamily member 6 (TNFRSF6), is a protein that in humans is encoded by the FAS gene. Fas was first identified using a monoclonal antibody generated by immunizing mice with the FS-7 cell line. Thus, the name Fas is derived from FS-7-associated surface antigen. The Fas receptor is a death receptor on the surface of cells that leads to programmed cell death (apoptosis) if it binds its ligand, Fas ligand (FasL). It is one of two apoptosis pathways, the other being the mitochondrial pathway.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86101970480

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1216 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Scotticus Finch
New York, US
★★★★★ 5
Great monitor!
Excellent product and value! Great quality, makes gaming awesome.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
G
Verified Purchase
Greycie
Port Orchard, US
★★★★★ 4
Overall AMAZING moniter for the price
It dose everything it said it did without any downsides thus far. I will say having it grouped with all the other monitors in the listing kinda skews the reviews for all the monitors and the HDR 400 certification not being a real HDR value is a bit scummy for marketing however over all its a amazing monitor. virtually 0 input lantancy as far as i can tell and its more than bright enough for me. Its color calibration is a bit off by default but can be easily fixed by switching to the cool setting. I was expecting it to come with a display port cable but it only came with a HDMI cable. I would have liked to see a display port cable but i understand why its a HDMI cable. It was very easy to setup and easy to use as its just the stand, the monitor, and the HDMI and power cords. The monitor stand is nice but its obviously where Koorui cheaped out however for a monitor of this price you cant beat it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 20, 2025
Y
Verified Purchase
Yanepsy
Whiting, US
★★★★★ 5
Excellent Budget Gaming Monitor
I’m very impressed with this monitor for the price. The 200Hz refresh rate makes gameplay feel incredibly smooth, especially in fast-paced games. The picture quality is sharp, colors look good, and the screen size is perfect for both gaming and everyday use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
F
Verified Purchase
Frost
Cuba, US
★★★★★ 5
Best price best product
Worth it still got it after year 4 of it and haven't had a issue . Hits the high resolution it says it has but I doubt it's over 166hz ... even tho it claims unlimited lol ... decent for first time setup . I hit about 145 hours to 155hz max .... crisp big monitor make sure you use proper cables
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
T
Verified Purchase
TekkenG
Omaha, US
★★★★★ 1
Better off saving your money for a quality brand like Acer or Samsung
If you were looking for a decent gaming monitor with a good refresh rate, you better keep looking. Honestly, I wanted to really like this thing. For $120, it ticked off a lot of great features for me: at least 120Hz refresh rate, 1080p quality, and some nifty reticule marks for FPS gamers like myself. And for a year I had no problems with it until a few days ago. The ability to control input's, power, and toggle the reticule features all lie on one singular button behind the monitor. Here lie's the issue; if that power button starts messing up, there is no way to control or turn on/off the monitor. This is exactly what happened on my unit; the power button/control went out and the monitor was basically useless. I contacted Koorui support via email, and all I got was a vague "Did you confirm the button is really broken" response. Replied back that I did, and the manufacturer has ghosted me. Basically, I HIGHLY advise you just save up a few $80 or $100 dollars and get a decent entry level gaming monitor. By going cheap with this one, you will just end up probably wearing out the power/control button and be left with an expensive paperweight. If you are DIY repair savvy, I am sure that replacing the power/control button probably is not that big of a deal. In which case, go right ahead as it is a decent monitor for the price. But with that said, having this thing break leaves you with basically no options to get it fixed and good luck trying to get a hold of Koorui for support. Sadly, this is a growing trend on buying electronic's here on amazon from smaller brand sellers. *Update* So as of writing this review, I got Koorui to reach out to me. They would agree to replace the monitor for free, but I would have to front the shipping costs. They have their operations out in California, so if you live on the east coast then expect to pay around $40-50 for shipping for the monitor all the way out there (nearly half the monitor's value). I told Koorui that this just did not make any financial sense and they offered to refund me 50% of the monitor's value. However, they have yet to specify how they will send the refund, so I am unsure of whether I will see my partial refund when this is all said and done. So know that if you do proceed to get this monitor and need to return it past the 30 day return window covered by Amazon. TLDR: just save up an extra $50-100 for a big brand gaming monitor and save yourself the headache of dealing with all of this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2024

recommand products